Linear peptide
VIP
28-amino-acid linear peptide studied in peptide signaling and receptor pathway research.
Strength 10 mg
- Lot-specific certificate with every order
- Insulated dispatch from La Jolla, CA
Research use only. Not for human or animal consumption. Not for therapeutic, clinical, diagnostic, dietary supplement, dosing, injection, ingestion or administration use. By ordering, the buyer confirms qualified research use.
01 · Identity
- Class
- Linear peptide
- Form
- Lyophilized powder, sealed vial
- SKU
- VIP
- CAS
- 37221-79-7
- Formula · weight
- C147H237N43O43S · 3326.8 g/mol
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Also searched as
- vasoactive intestinal peptide
02 · This lot
Certificate on fileNo lot released yet.
03 · Analytical data
Published with the first released lot.
The chromatogram and mass confirmation are published here the day this material's certificate is released.
04 · Handling
Form, storage and shipping.
- Form
- Lyophilized powder, sealed vial
- Storage
- −20 °C long term, 2 to 8 °C short term, protect from light and moisture
- Shipping
- Ambient, insulated, cold pack on request
- Documentation
- Lot-specific certificate of analysis with every order
05 · Research context
What has been studied.
VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid linear peptide reference standard. It is studied in laboratory research involving peptide signaling, receptor pathways, analytical characterization, and controlled in-vitro research models.
06 · Related standards
