Linear peptide
Sermorelin
Synthetic GHRH(1-29) analogue for laboratory research.
$45
1
- Lot-specific certificate with every order
- Insulated dispatch from La Jolla, CA
Research use only. Not for human or animal consumption. Not for therapeutic, clinical, diagnostic, dietary supplement, dosing, injection, ingestion or administration use. By ordering, the buyer confirms qualified research use.
01 · Identity
- Class
- Linear peptide
- Form
- Lyophilized powder, sealed vial
- SKU
- SERM
- CAS
- 86168-78-7
- Formula · weight
- C149H246N44O42S · 3357.9 g/mol
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Also searched as
- GRF 1-29, GHRH 1-29
02 · This lot
Certificate on fileNo lot released yet.
03 · Analytical data
Published with the first released lot.
The chromatogram and mass confirmation are published here the day this material's certificate is released.
04 · Handling
Form, storage and shipping.
- Form
- Lyophilized powder, sealed vial
- Storage
- −20 °C long term, 2 to 8 °C short term, protect from light and moisture
- Shipping
- Ambient, insulated, cold pack on request
- Documentation
- Lot-specific certificate of analysis with every order
05 · Research context
What has been studied.
Sermorelin is a synthetic analogue of growth hormone-releasing hormone. Research focuses on its receptor-binding and signaling activity in animal and cellular models, particularly in studies of the GHRH-GH-IGF-1 axis.
06 · Related standards
